PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G126600.3
Common NameB456_012G126600, LOC105780790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 423aa    MW: 46645.4 Da    PI: 6.8562
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G126600.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27160213256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         ++++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Gorai.012G126600.3 160 KKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 213
                         689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.315156215IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-26157216IPR009057Homeodomain-like
SuperFamilySSF466891.88E-18158216IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-26160213IPR006447Myb domain, plants
PfamPF002494.5E-8162211IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MLAVSPLRNT RNDENKGKME SFSIISSEEF PDFAEGNLLE SIDFDDLFIG IDEGDMLPDL  60
EMDPEILADL PTSRCDVEES MNTSVEKTDE DSSQRKEEEE EEDKISGSGS GSSSSKGEEI  120
FSKREEPNAV DKTPSKYAVK GRKSSAAQAK NNNQGKRKTK KVDWTPELHR RFVQAVEQLG  180
VDKAVPSRIL ELMGIDCLTR HNIASHLQKY RSHRKHLLAR EAEAANWTQR RQMYGGAATP  240
AGGGKRDISP WLAPTMGFPP MSPMHHHHFR PLHVWGHPTL DQSLVHLWTK HPAHTTSQPP  300
QPPQSTWGPP PANPSFWHHH HQRVSNGLTP GTPCFPQPIA PTRFRAAPVP GIPPHHHGTG  360
GQSGPHPLID FHPSKESIDA AIGDVLTKPW LPLPLGLKPP STDSVLGELQ RQGVPKIPPS  420
CA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15157211357ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT4288704e-43KT428870.1 UNVERIFIED: Ilex paraguariensis isolate E3 transcription activator GLK1-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460750.10.0PREDICTED: transcription activator GLK1-like isoform X3
SwissprotQ9SIV31e-101GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A0D2V5T50.0A0A0D2V5T5_G
STRINGPOPTR_0007s01230.11e-175(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.13e-76GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]